PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011086052.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family Dof
Protein Properties Length: 327aa    MW: 35413.2 Da    PI: 7.3794
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011086052.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.3e-3955114362
          zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +  lkcprCds+ntkfCyynnyslsqPryfCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  XP_011086052.1  55 QPPLKCPRCDSSNTKFCYYNNYSLSQPRYFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 114
                     5679*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-2752112IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3357112IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.34858112IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106096IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MPAANCENLY TTATSSPTHQ CPQKQIVADV QNSSFPSSSP TNNSVMQRSN QDPHQPPLKC  60
PRCDSSNTKF CYYNNYSLSQ PRYFCKACKR YWTRGGTLRN VPVGGGCRKN KRVKQRQLAP  120
SIGSDGISSS SSSAAASTAI IKPSSVQPDI DLSPAPNLIN EPLLYSLPTN PFELNFPFSR  180
FSTARVSCDS SGFDHHQPGM NGVGIGFSSG ILEKGDYRNG FRQIEDVITS SAGNVNSLFF  240
GPSNFGPTST MVSLLSSPHQ EANDFHGEDM QMQNGGLMGK EVKIEGENRS DFNSSDSSSL  300
LWNSSTSLGE WFDPSNIMGS SSVPSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0737624e-58KJ073762.1 Sesamum indicum clone TilSSR_44963 microsatellite Sesame_44963 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086052.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A068TVZ01e-70A0A068TVZ0_COFCA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-34TARGET OF MONOPTEROS 6